PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Thhalv10022154m
Common NameEUTSA_v10022154mg
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Eutremeae; Eutrema
Family M-type_MADS
Protein Properties Length: 176aa    MW: 20162 Da    PI: 9.5458
Description M-type_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Thhalv10022154mgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF60.61.8e-191157349
                     --SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEE CS
           SRF-TF  3 ienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyey 49
                     ++++  +qvtfskRr g++KKA+EL +LC+aev +++fs+ +k y +
  Thhalv10022154m 11 VQDTNTKQVTFSKRRLGLFKKASELATLCNAEVGIVVFSPGNKPYSF 57
                     6788899*********************************9998877 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM004323.1E-32160IPR002100Transcription factor, MADS-box
PROSITE profilePS5006625.105161IPR002100Transcription factor, MADS-box
SuperFamilySSF554558.63E-26173IPR002100Transcription factor, MADS-box
PRINTSPR004041.1E-18323IPR002100Transcription factor, MADS-box
PfamPF003193.5E-231157IPR002100Transcription factor, MADS-box
PRINTSPR004041.1E-182338IPR002100Transcription factor, MADS-box
PRINTSPR004041.1E-183859IPR002100Transcription factor, MADS-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 176 aa     Download sequence    Send to blast
MGRRKIKMEK VQDTNTKQVT FSKRRLGLFK KASELATLCN AEVGIVVFSP GNKPYSFGKP  60
NFDLIAERFM NESEDSDSCE RSGYRRGNRA RQEKMICKRL NSIIEEAEAE KKRGENLQIW  120
LETAGEERFN RPIEDLTLEE LKEFEAKMER MHGGIQGNIN HMRASSSLVI LSKEK*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1tqe_P2e-16178178Myocyte-specific enhancer factor 2B
1tqe_Q2e-16178178Myocyte-specific enhancer factor 2B
1tqe_R2e-16178178Myocyte-specific enhancer factor 2B
1tqe_S2e-16178178Myocyte-specific enhancer factor 2B
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006407920.11e-126hypothetical protein EUTSA_v10022154mg
SwissprotO647037e-71AGL29_ARATH; Agamous-like MADS-box protein AGL29
TrEMBLV4MA981e-126V4MA98_EUTSA; Uncharacterized protein
STRINGAT3G66656.11e-86(Arabidopsis thaliana)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM8628390
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G66656.13e-90AGAMOUS-like 91